PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000165715
Common NameMYB34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 317aa    MW: 34520.2 Da    PI: 7.8821
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000165715genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.5e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++vk +G+++W++I++ ++ gR++k+c++rw + 
    MDP0000165715 12 KGPWSPEEDEALQNLVKIYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding49.87.8e-1666108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEd+  ++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000165715  66 PFSPEEDDTXIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.149762IPR017930Myb domain
SuperFamilySSF466891.05E-319105IPR009057Homeodomain-like
SMARTSM007172.6E-171160IPR001005SANT/Myb domain
PfamPF002493.6E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-241363IPR009057Homeodomain-like
CDDcd001671.05E-161456No hitNo description
SMARTSM007176.1E-1363111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2264112IPR009057Homeodomain-like
PROSITE profilePS5129419.11564113IPR017930Myb domain
CDDcd001677.35E-1166109No hitNo description
PfamPF002491.5E-1366108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MASTKKVVDR IKGPWSPEED EALQNLVKIY GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
EVEHRPFSPE EDDTXIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSSMSEDL  120
CSDVHDHPPH KRSASVGAVS GTGLYFNPGS PSGSDLSDSS LHGGVSPSSQ VFTPXARPVP  180
PPIAPPPMEA ATSAVAVDPP TSLSLSLPGS ESESCDGSNH MGSGFGSNPI VGPTQMVEQP  240
HEVAAPPPVV GLLPPPRQSN LNNNQQFFSS EFLDVMQEMI RKEVRNYMTG IEQKGQCMQT  300
EAIRNAVIKR IXISKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-39111123104C-Myb DNA-Binding Domain
1mse_C5e-39111123104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.126450.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6273120.0AB627312.1 Malus x domestica mRNA, microsatellite: MEST188, clone: SAM01_20_H07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008367655.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-86MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ620.0D9ZJ62_MALDO; MYB domain class transcription factor
STRINGPOPTR_0002s12410.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-70myb domain protein 73